Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-14, Canine

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-14 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf14-protein-canine.html

Purity

98.0

Smiles

KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT

Molecular Formula

100050897 (Gene_ID) XP_003363267.1 (K64-T252) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF675 activation kit by CRISPRa
GA116241 1 Kit

Human ZNF675 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS631287 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Tnni3 (NM_009406) Mouse Tagged ORF Clone
MG202282 10 µg

Tnni3 (NM_009406) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MASA (ENOPH1) Mouse Monoclonal Antibody [Clone ID: OTI4A8]
CF810905 100 µg

MASA (ENOPH1) Mouse Monoclonal Antibody [Clone ID: OTI4A8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS637716 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details