Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-14, Canine

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-14 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf14-protein-canine.html

Purity

98.0

Smiles

KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT

Molecular Formula

100050897 (Gene_ID) XP_003363267.1 (K64-T252) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNST ORF Vector (Human) (pORF)
ORF017548 1.0 µg DNA

CNST ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MCAM Protein Lysate
OCOA12076-20UG 20 µg

MCAM Protein Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal XAB1 Antibody
NBP1-90072 0.1 mL

Rabbit Polyclonal XAB1 Antibody

Sign In for Pricing
View Details
Recombinant Human XKR5 Protein, His (Fc)-Avi-tagged
XKR5-4313H 50 µg

Recombinant Human XKR5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Stat3 Polyclonal Antibody
E041465 100 µg -100 µL

Stat3 Polyclonal Antibody

Sign In for Pricing
View Details
ACER1 Antibody
CSB-PA906051-01 50 µg

ACER1 Antibody

Sign In for Pricing
View Details