Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 5 (FGF5)

Product Specifications

Product Name Alternative

(FGF-5) (Heparin-binding growth factor 5) (HBGF-5) (Smag-82)

Abbreviation

Recombinant Human FGF5 protein

Gene Name

FGF5

UniProt

P12034

Expression Region

21-268aa

Organism

Homo sapiens (Human)

Target Sequence

HGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

62.4 kDa

References & Citations

Expression of the murine fibroblast growth factor 5 gene in the adult central nervous system.Haub O., Drucker B., Goldfarb M.Proc. Natl. Acad. Sci. U.S.A. 87:8022-8026 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl trans-2-(4-aminocyclohexyl)acetate hydrochloride
TRC-E899695-500MG 500 mg

Ethyl trans-2-(4-aminocyclohexyl)acetate hydrochloride

Sign In for Pricing
View Details
IRF3 (NM_001197124) Human Over-expression Lysate
LY434143 100 µg

IRF3 (NM_001197124) Human Over-expression Lysate

Sign In for Pricing
View Details
VPS16 Rabbit Polyclonal Antibody
TA365135 100 µL

VPS16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIPK1 Mouse Monoclonal Antibody [Clone ID: OTI2C11]
CF807260 100 µg

HIPK1 Mouse Monoclonal Antibody [Clone ID: OTI2C11]

Sign In for Pricing
View Details
IP6K2 Polyclonal Antibody
E-AB-19095-01 20 µL

IP6K2 Polyclonal Antibody

Sign In for Pricing
View Details
IP6K2 Polyclonal Antibody
E-AB-19095-02 60 µL

IP6K2 Polyclonal Antibody

Sign In for Pricing
View Details