Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTS, Human (His)

PTS proteins are critical in the biosynthesis of tetrahydrobiopterin, an important cofactor for aromatic amino acid hydroxylase. It catalyzes the conversion of 7,8-dihydroneopterin triphosphate to 6-pyruvoyltetrahydropterin, a key step in the biosynthetic pathway. PTS Protein, Human (His) is the recombinant human-derived PTS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PTS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pts-protein-human-his.html

Purity

95.20

Smiles

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Molecular Formula

5805 (Gene_ID) Q03393 (M1-E145) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit
MBS107063-01 48 Well

Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit

Sign In for Pricing
View Details
Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit
MBS107063-02 96 Well

Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit

Sign In for Pricing
View Details
Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit
MBS107063-03 5x 96 Well

Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit

Sign In for Pricing
View Details
Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit
MBS107063-04 10x 96 Well

Bovine Fibroblast Growth Factor 1, Acidic ELISA Kit

Sign In for Pricing
View Details
Recombinant Neurospora crassa Anthranilate synthase component 2 (trp-1), partial
MBS1199837 Inquire

Recombinant Neurospora crassa Anthranilate synthase component 2 (trp-1), partial

Sign In for Pricing
View Details
XRCC4 Rabbit Polyclonal Antibody (Fluoro488)
orb3116830 100 µg

XRCC4 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details