Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTS, Human (His)

PTS proteins are critical in the biosynthesis of tetrahydrobiopterin, an important cofactor for aromatic amino acid hydroxylase. It catalyzes the conversion of 7,8-dihydroneopterin triphosphate to 6-pyruvoyltetrahydropterin, a key step in the biosynthetic pathway. PTS Protein, Human (His) is the recombinant human-derived PTS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PTS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pts-protein-human-his.html

Purity

95.20

Smiles

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Molecular Formula

5805 (Gene_ID) Q03393 (M1-E145) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLDB3 Human Over-expression Lysate
orb1375489 20 µg

PHLDB3 Human Over-expression Lysate

Sign In for Pricing
View Details
Nceh1 (NM_001127524) Rat Untagged Clone
RN203503 10 µg

Nceh1 (NM_001127524) Rat Untagged Clone

Sign In for Pricing
View Details
Nup188 shRNA (h) Lentiviral Particles
sc-92946-V 200 µL

Nup188 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Tupaia chinensis CD4 Polyclonal Antibody
E55A05419 100 µg

Tupaia chinensis CD4 Polyclonal Antibody

Sign In for Pricing
View Details
ERVS71-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV724622 1.0 µg DNA

ERVS71-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYCU2-2 Polyclonal Antibody
MBS9011202 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYCU2-2 Polyclonal Antibody

Sign In for Pricing
View Details