Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thy1/CD90, Cynomolgus (HEK293, His)

Thy1/CD90 Protein is a member of the immunoglobulin family. It plays a role in cell adhesion and cell communication in many cell types, especially in cells of the immune and nervous systems.Thy1/CD90 protein has multiple immune functions and also participates in the regulation of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. Thy1/CD90 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Thy1/CD90 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thy1-cd90-protein-cynomolgus-hek293-his.html

Purity

95.00

Smiles

QKVTSLTACLVDQSLRLDCRHENTTSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVK

Molecular Formula

102139037 (Gene_ID) A0A2K5U4H6 (Q20-K129) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF488A conjugate, 0.1mg/mL
BNC882295-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (124), CF568 conjugate, 0.1mg/mL
BNC680530-500 1x 500 µL

Bcl-2 (124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), 0.2mg/mL
BNUB1045-100 1x 100 µL

CD16 (C16/1045), 0.2mg/mL

Sign In for Pricing
View Details