Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-1, Human (HEK293, His)

IGFBP-1 protein extends the half-life of IGFs and modulates their activity. It can inhibit or stimulate IGFs' growth-promoting effects, altering their interaction with receptors and fine-tuning signaling pathways. IGFBP-1 promotes cell migration and binds to both IGF1 and IGF2, highlighting its versatile role in modulating IGF signaling pathways. IGFBP-1 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-bp-1-protein-human-hek-293-his.html

Purity

98.00

Smiles

APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Molecular Formula

3484 (Gene_ID) P08833 (A26-N259) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Marker Ladder (500-10kb)
10430007-1 500 μL

DNA Marker Ladder (500-10kb)

Sign In for Pricing
View Details
NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)
abx309308-01 20 µg

NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)

Sign In for Pricing
View Details
NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)
abx309308-02 50 µg

NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)

Sign In for Pricing
View Details
NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)
abx309308-03 100 µg

NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)

Sign In for Pricing
View Details
NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)
abx309308-04 200 µg

NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)

Sign In for Pricing
View Details
NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)
abx309308-05 1 mg

NEDD4 Binding Protein 2 Like 2 (N4BP2L2) Antibody (Biotin)

Sign In for Pricing
View Details