Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, Fc)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, Fc) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-fc.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

Approximately 120-200 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLH2 rabbit pAb
UB-GEN-11312 100 µL

CLH2 rabbit pAb

Sign In for Pricing
View Details
Rat Pulmonary surfatcant-associated protein B (SP-B) ELISA Kit
YP-W30351-01 48 Tests

Rat Pulmonary surfatcant-associated protein B (SP-B) ELISA Kit

Sign In for Pricing
View Details
Rat Pulmonary surfatcant-associated protein B (SP-B) ELISA Kit
YP-W30351-02 96 Tests

Rat Pulmonary surfatcant-associated protein B (SP-B) ELISA Kit

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica rpsF Protein (aa 1-130) (strain 8081)
VAng-Wyb1801-50gEcoli 50 µg (E. coli)

Recombinant Yersinia Enterocolitica rpsF Protein (aa 1-130) (strain 8081)

Sign In for Pricing
View Details
QRSL1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV742212 1.0 µg DNA

QRSL1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
(2-Bbromo-4-methylphenyl) hydrazine hydrochloride
OR1041573-01 250 mg

(2-Bbromo-4-methylphenyl) hydrazine hydrochloride

Sign In for Pricing
View Details