Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM5, Human (HEK293, Fc)

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, Fc) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CEACAM5 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam5-protein-human-hek-293-fc.html

Purity

98.0

Smiles

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Formula

1048 (Gene_ID) P06731-1 (K35-A685) (Accession)

Molecular Weight

Approximately 120-200 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Peroxiredoxin 3 ELISA Kit
MBS7280234-01 48 Well

Porcine Peroxiredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Peroxiredoxin 3 ELISA Kit
MBS7280234-02 96 Well

Porcine Peroxiredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Peroxiredoxin 3 ELISA Kit
MBS7280234-03 5x 96 Well

Porcine Peroxiredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Peroxiredoxin 3 ELISA Kit
MBS7280234-04 10x 96 Well

Porcine Peroxiredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Human ZFP37 Pre-designed siRNA Set A
SI018551A 1 Each

Human ZFP37 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Prednisone-d8
462955-01 250 µg

Prednisone-d8

Sign In for Pricing
View Details