Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-beta/CXCL2, Rat

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-beta/CXCL2 Protein, Rat is produced in E. coli, and consists of 69 amino acids (A32-N100) .

Product Specifications

Product Name Alternative

GRO-beta/CXCL2 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-beta-cxcl2-protein-rat.html

Purity

95.0

Smiles

SELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN

Molecular Formula

114105 (Gene_ID) P30348 (S32-N100) (Accession)

Molecular Weight

Approximately 7.6 kDa

References & Citations

[1]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[2]Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[3]Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32 (4) :353-68.|[4]Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55 (1) :48-55.|[5]Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558.|[6]E C O'Leary, et al. Glucocorticoid-mediated inhibition of neutrophil emigration in an endotoxin-induced rat pulmonary inflammation model occurs without an effect on airways MIP-2 levels. Am J Respir Cell Mol Biol. 1997 Mar;16 (3) :267-74.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG (H&L) Antibody Fluorescein Conjugated Pre-Adsorbed
TA398041 1 mg

Rat IgG (H&L) Antibody Fluorescein Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
COX6A1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F1]
TA501397BM 100 µL

COX6A1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F1]

Sign In for Pricing
View Details
2-Bromophenylethylamine
TRC-B683640-2.5G 2.5 g

2-Bromophenylethylamine

Sign In for Pricing
View Details
CD3e (RIV9), Biotin conjugate, 0.1mg/mL
BNCB0322-500 1x 500 µL

CD3e (RIV9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KAAG1 Human Gene Knockout Kit (CRISPR)
KN217041BN 1 Kit

KAAG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details