Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-beta/CXCL2, Rat

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-beta/CXCL2 Protein, Rat is produced in E. coli, and consists of 69 amino acids (A32-N100) .

Product Specifications

Product Name Alternative

GRO-beta/CXCL2 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-beta-cxcl2-protein-rat.html

Purity

95.0

Smiles

SELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN

Molecular Formula

114105 (Gene_ID) P30348 (S32-N100) (Accession)

Molecular Weight

Approximately 7.6 kDa

References & Citations

[1]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[2]Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[3]Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32 (4) :353-68.|[4]Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55 (1) :48-55.|[5]Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558.|[6]E C O'Leary, et al. Glucocorticoid-mediated inhibition of neutrophil emigration in an endotoxin-induced rat pulmonary inflammation model occurs without an effect on airways MIP-2 levels. Am J Respir Cell Mol Biol. 1997 Mar;16 (3) :267-74.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNIP1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-11260R-PE-Cy7 100 µL

SNIP1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
CCDC116 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV658787 1.0 µg DNA

CCDC116 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
UBE2K Antibody, FITC conjugated
CSB-PA09667C0Rb-01 50 µg

UBE2K Antibody, FITC conjugated

Sign In for Pricing
View Details
UBE2K Antibody, FITC conjugated
CSB-PA09667C0Rb-02 100 µg

UBE2K Antibody, FITC conjugated

Sign In for Pricing
View Details
Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant
CZ9055-C_R-01 0.5 mg

Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant

Sign In for Pricing
View Details
Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant
CZ9055-C_R-02 1 mg

Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant

Sign In for Pricing
View Details