DKK-1, Mouse (CHO)
Dkk-1 Protein, Mouse (CHO) is shown to be a potent inhibitor of Wnt signaling and member of dickkopf family.
Product Specifications
Product Name Alternative
DKK-1 Protein, Mouse (CHO), Mouse, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dkk-1-protein-mouse-cho.html
Purity
95.00
Smiles
SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQAS
Molecular Formula
13380 (Gene_ID) O54908 (S30-H272) (Accession)
Molecular Weight
Approximately 19-22 kDa due to the glycosylation.
References & Citations
[1]Glinka A, et al. Dickkopf-1 is a member of a new family of secreted proteins and functions in head induction. Nature. 1998 Jan 22;391 (6665) :357-62.|[2]Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Dev Cell. 2001 Sep;1 (3) :423-34.|[3]Niida A, et al. DKK1, a negative regulator of Wnt signaling, is a target of the beta-catenin/TCF pathway. Oncogene. 2004 Nov 4;23 (52) :8520-6.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472885-500 1x 500 µL
CD81 / TAPA-1 (C81/2885R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941920-500 1x 500 µL
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![CD22 Mouse Monoclonal Antibody [A2G6]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82806/imageurl/em1902-13.webp)
