Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Beta-2-microglobulin (B2M)

Product Specifications

Product Name Alternative

(Lactollin)

Abbreviation

Recombinant Pig B2M protein

Gene Name

B2M

UniProt

Q07717

Expression Region

21-118aa

Organism

Sus scrofa (Pig)

Target Sequence

VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Tag

Tag-free

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the class I major histocompatibility complex (MHC) . Involved in the presentation of peptide antigens to the immune system.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.5 kDa

References & Citations

"Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides." Zhang N., Qi J., Feng S., Gao F., Liu J., Pan X., Chen R., Li Q., Chen Z., Li X., Xia C., Gao G.F. J Virol 85:11709-11724 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-879-5p miRNA Mimic
CMR0290-01 5 nmol

Rno-miR-879-5p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-879-5p miRNA Mimic
CMR0290-02 10 nmol

Rno-miR-879-5p miRNA Mimic

Sign In for Pricing
View Details
Suptavumab Human Monoclonal Antibody
orb2978032-01 100 µg

Suptavumab Human Monoclonal Antibody

Sign In for Pricing
View Details
Suptavumab Human Monoclonal Antibody
orb2978032-02 1 mg

Suptavumab Human Monoclonal Antibody

Sign In for Pricing
View Details
Anti-PRR11 Mouse Monoclonal Antibody [Clone ID: OTI2A10]
M10121 100 µL

Anti-PRR11 Mouse Monoclonal Antibody [Clone ID: OTI2A10]

Sign In for Pricing
View Details
Goat Chicken IgY (H&L) FITC Antibody
orb734564-01 100 µL

Goat Chicken IgY (H&L) FITC Antibody

Sign In for Pricing
View Details