Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Mouse (HEK293, His)

The TROP-2 protein functions as a growth factor receptor and has been shown to play a critical role in mediating cellular responses associated with growth regulation. Its involvement indicates that it plays a crucial role in signal transduction during cell growth. TROP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-mouse-hek-293-his.html

Purity

95.04

Smiles

QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAG

Molecular Formula

56753 (Gene_ID) Q8BGV3 (Q25-G270) (Accession)

Molecular Weight

38-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 S - Trimer/S6P (RRAR-GSAS Recombinant Protein
PPT-16988 100 µg

SARS-CoV-2 S - Trimer/S6P (RRAR-GSAS Recombinant Protein

Sign In for Pricing
View Details
Presenilin 1 (PS-1) Porcine ELISA Kit
G0788 96 Tests

Presenilin 1 (PS-1) Porcine ELISA Kit

Sign In for Pricing
View Details
Cow Dipeptidyl Peptidase 4 / CD26 (DPP4) ELISA Kit
abx514299 96 Tests

Cow Dipeptidyl Peptidase 4 / CD26 (DPP4) ELISA Kit

Sign In for Pricing
View Details
[1,1'-Bis(diphenylphosphino)ferrocene]dichloropalladium(II)
JH750641 1 Each

[1,1'-Bis(diphenylphosphino)ferrocene]dichloropalladium(II)

Sign In for Pricing
View Details
mmu-miR-3074-5p Primers
MPM00321 150 µL / 10 µM

mmu-miR-3074-5p Primers

Sign In for Pricing
View Details
Sel-1L3 Double Nickase Plasmid (h2)
sc-411696-NIC-2 20 µg

Sel-1L3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details