Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Mouse (Biotinylated, HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Mouse (Biotinylated, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-mouse-biotinylated-hek293-his.html

Purity

95.00

Smiles

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Formula

12478 (Gene_ID) P25918 (G17-G287) (Accession)

Molecular Weight

Approximately 31 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human F box/WD repeat containing protein 5 (FBXW5) ELISA kit
GTR10403782 96 Well

Human F box/WD repeat containing protein 5 (FBXW5) ELISA kit

Sign In for Pricing
View Details
APPBP1 (10C4) Rabbit Monoclonal Antibody
E28M3074 100 µL

APPBP1 (10C4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DENND2A Rabbit Polyclonal Antibody (BF405)
orb2385480 100 µL

DENND2A Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Human ZNF788P Protein
E30P64898A 50 µg

Recombinant Human ZNF788P Protein

Sign In for Pricing
View Details
RG9MTD3 Protein Vector (Human) (pPB-N-His)
PV057110 500 ng

RG9MTD3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MAML3 Antibody
orb2640465 7 mL

MAML3 Antibody

Sign In for Pricing
View Details