Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHD1L, Human (His-SUMO)

CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK (ATP) channel) . ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CHD1L Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chd1l-protein-human-his-sumo.html

Smiles

SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP

Molecular Formula

9557 (Gene_ID) Q86WJ1 (S704-P897) (Accession)

Molecular Weight

Approximately 37.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human YJU2 shRNA (UAS) - Lentiviral human YJU2 shRNA (UAS, RFP) (100)
GTR15100812 1 Vial

Lentiviral human YJU2 shRNA (UAS) - Lentiviral human YJU2 shRNA (UAS, RFP) (100)

Ask
View Details
Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594
MBS4517194-01 0.1 mL

Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594

Ask
View Details
Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594
MBS4517194-02 0.5 mL

Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594

Ask
View Details
Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594
MBS4517194-03 1 mL

Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594

Ask
View Details
Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594
MBS4517194-04 5x 1 mL

Rabbit Anti-Monkey IgG (H&L) - Alexa Fluor 594

Ask
View Details
HSV-2 gC (Herpes Simplex Virus Type 2 glycoprotein C)
375977 100 µg

HSV-2 gC (Herpes Simplex Virus Type 2 glycoprotein C)

Ask
View Details