Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHD1L, Human (His-SUMO)

CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK (ATP) channel) . ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CHD1L Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chd1l-protein-human-his-sumo.html

Smiles

SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP

Molecular Formula

9557 (Gene_ID) Q86WJ1 (S704-P897) (Accession)

Molecular Weight

Approximately 37.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SCAND3 (ZBED9) (NM_052923) Human Tagged Lenti ORF Clone
RC211074L3 10 µg

SCAND3 (ZBED9) (NM_052923) Human Tagged Lenti ORF Clone

Ask
View Details
Mtrr Mouse siRNA Oligo Duplex (Locus ID 210009)
SR419236 1 Kit

Mtrr Mouse siRNA Oligo Duplex (Locus ID 210009)

Ask
View Details
L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride
260863-01 50 mg

L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride

Ask
View Details
L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride
260863-02 100 mg

L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride

Ask
View Details
L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride
260863-03 250 mg

L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride

Ask
View Details
L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride
260863-04 500 mg

L-Arginine-[4-nitro-3- (carboxy-iso-propyl amid) -phenyl] ester dihydrochloride

Ask
View Details