Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Gli3 (Recombinant Rabbit, Monoclonal, IgG)
A113621 100 µL

Anti-Gli3 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
TPM4, NT (TPM4, Tropomyosin alpha-4 chain, TM30p1, Tropomyosin-4) (MaxLight 750) discontinued
043160-ML750 100 µL

TPM4, NT (TPM4, Tropomyosin alpha-4 chain, TM30p1, Tropomyosin-4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal SLC7A5/LAT1 Antibody (BU53) [PE]
FAB10390P 0.1 mL

Mouse Monoclonal SLC7A5/LAT1 Antibody (BU53) [PE]

Sign In for Pricing
View Details
Eugenol-d3
TRC-E938642-5MG 5 mg

Eugenol-d3

Sign In for Pricing
View Details
Mouse Proopiomelanocortin (POMC) ELISA Kit
RDR-POMC-Mu-01 96 Tests

Mouse Proopiomelanocortin (POMC) ELISA Kit

Sign In for Pricing
View Details
Mouse Proopiomelanocortin (POMC) ELISA Kit
RDR-POMC-Mu-02 48 Tests

Mouse Proopiomelanocortin (POMC) ELISA Kit

Sign In for Pricing
View Details