Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNTL1 ORF Vector (Human) (pORF)
ORF013133 1.0 µg DNA

GALNTL1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RNF26 Antibody, HRP conjugated
A33366-50UG 50 µg

RNF26 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Catalase Antibody (OTI1B8) [Alexa Fluor 488]
NBP2-70342AF488 0.1 mL

Mouse Monoclonal Catalase Antibody (OTI1B8) [Alexa Fluor 488]

Sign In for Pricing
View Details
Electronic Pipette
21011413 1 PC

Electronic Pipette

Sign In for Pricing
View Details
Zfp364 3'UTR Lenti-reporter-Luc Vector
50936086 1.0 µg

Zfp364 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 5 (GRM5) (NM_001143831) Human Over-expression Lysate
LS002915-20ug 20 µg

Metabotropic Glutamate Receptor 5 (GRM5) (NM_001143831) Human Over-expression Lysate

Sign In for Pricing
View Details