Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutathione Reductase (GR) ELISA Kit
RDR-GR-Hu-48Tests 48 Tests

Human Glutathione Reductase (GR) ELISA Kit

Sign In for Pricing
View Details
5-Aminononane-5-carboxylic Acid
TRC-A615215-1G 1 g

5-Aminononane-5-carboxylic Acid

Sign In for Pricing
View Details
LOC305806 Rat shRNA Lentiviral Particle (Locus ID 305806)
TL702127V 500 µL Each

LOC305806 Rat shRNA Lentiviral Particle (Locus ID 305806)

Sign In for Pricing
View Details
Lentiviral mouse Lce1k shRNA (UAS) - Lentiviral mouse Lce1k shRNA (UAS) (25)
GTR15299288 1 Vial

Lentiviral mouse Lce1k shRNA (UAS) - Lentiviral mouse Lce1k shRNA (UAS) (25)

Sign In for Pricing
View Details
MTND2P8 Recombinant Protein (Human)
RP076788 100 µg

MTND2P8 Recombinant Protein (Human)

Sign In for Pricing
View Details
MATK Human shRNA Plasmid Kit (Locus ID 4145)
TL320414 1 Kit

MATK Human shRNA Plasmid Kit (Locus ID 4145)

Sign In for Pricing
View Details