Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP19-9P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV730723 1.0 µg DNA

KRTAP19-9P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Microtubule-Associated Protein Tau Phospho-217 (MAPT p217) ELISA Kit
abx050327 96 Tests

Mouse Microtubule-Associated Protein Tau Phospho-217 (MAPT p217) ELISA Kit

Sign In for Pricing
View Details
GJC3 Protein Vector (Human) (pPM-C-HA)
PV080639 500 ng

GJC3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Polyclonal Antibody to HDAC5 (Phospho-Ser498)
35-1183-50 50 μL

Polyclonal Antibody to HDAC5 (Phospho-Ser498)

Sign In for Pricing
View Details
ADH5P2 Human qPCR Primer Pair (XM_291500)
HP221419 200 Reactions

ADH5P2 Human qPCR Primer Pair (XM_291500)

Sign In for Pricing
View Details
Tubulin Beta (TUBB) ELISA Kit
abx156857-01 96 Tests

Tubulin Beta (TUBB) ELISA Kit

Sign In for Pricing
View Details