Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TCEANC Antibody
NBP1-81184 0.1 mL

Rabbit Polyclonal TCEANC Antibody

Sign In for Pricing
View Details
Anti-DNA Antibody (17s.74)
RGK23801 100 μg

Anti-DNA Antibody (17s.74)

Sign In for Pricing
View Details
Polr1c (NM_001008330) Rat Tagged ORF Clone Lentiviral Particle
RR200906L4V 200 µL

Polr1c (NM_001008330) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Wdr12 shRNA (UAS) - Lentiviral mouse Wdr12 shRNA (UAS, iRFP) (100)
GTR15234675 1 Vial

Lentiviral mouse Wdr12 shRNA (UAS) - Lentiviral mouse Wdr12 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Human CHST1 CF
5316-ST-020 20 µg

Recombinant Human CHST1 CF

Sign In for Pricing
View Details
Galectin 9 antibody
70R-12123 100 ug

Galectin 9 antibody

Sign In for Pricing
View Details