HB-EGF, Human (HEK293, His)
HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
HB-EGF Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html
Purity
98.0
Smiles
LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Molecular Formula
1839 (Gene_ID) Q99075 (L20-L148) (Accession)
Molecular Weight
Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
GPR32P sgRNA CRISPR Lentivector (Human) (Target 3)
TRPM7, NT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (MaxLight 405)
TRPM7, NT (Transient Receptor Potential Cation Channel Subfamily M Member 7, Long Transient Receptor Potential Channel 7, LTrpC-7, Channel-kinase 1, CHAK1, LTRPC7) (MaxLight 405)
WNK4, NT (Putative protein kinase WNK4, PRKWNK4) (APC) discontinued