Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creatine kinase-M shRNA (h) Lentiviral Particles
sc-35109-V 200 µL

Creatine kinase-M shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Proteus mirabilis Flagellar operon control protein umoB (umoB), partial
MBS7070571 Inquire

Recombinant Proteus mirabilis Flagellar operon control protein umoB (umoB), partial

Sign In for Pricing
View Details
Cym Protein Vector (Mouse) (pPB-N-His)
PV169399 500 ng

Cym Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
HMGB2 Protein Vector (Human) (pPM-C-His)
PV019976 500 ng

HMGB2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FAM3B Protein Vector (Rat) (pPM-C-HA)
PV267520 500 ng

FAM3B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Rat Fibroblast growth factor 16 (Fgf16)
MBS1041654-01 0.02 mg (E-Coli)

Recombinant Rat Fibroblast growth factor 16 (Fgf16)

Sign In for Pricing
View Details