Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reelin (RELN) CytoSection
TS422655P5 25 Slides

Reelin (RELN) CytoSection

Sign In for Pricing
View Details
Olfr493 (NM_146310) Mouse Tagged Lenti ORF Clone
MR217220L4 10 µg

Olfr493 (NM_146310) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human PP2C alpha/PPM1A CF
4150-PP-050 50 µg

Recombinant Human PP2C alpha/PPM1A CF

Sign In for Pricing
View Details
UEV2V2 Peptide
abx269153 100 µg

UEV2V2 Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal SLC38A1 Antibody [DyLight 680]
NBP3-06520FR 0.1 mL

Rabbit Polyclonal SLC38A1 Antibody [DyLight 680]

Sign In for Pricing
View Details
Texas Red Conjugated Affinity Purified Anti-RABBIT IgG (H&L) (GOAT)
GWB-2CBA00 2 mg

Texas Red Conjugated Affinity Purified Anti-RABBIT IgG (H&L) (GOAT)

Sign In for Pricing
View Details