Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASTOR3 Human Gene Knockout Kit (CRISPR)
KN410344 1 Kit

CASTOR3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IL-21 GMP Protein CF
BT-021-GMP-01M/LQ 1 mg

Recombinant Human IL-21 GMP Protein CF

Sign In for Pricing
View Details
ACBD4 CRISPR Activation Plasmid (h2)
sc-407597-ACT-2 20 µg

ACBD4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Importin 13 (IPO13) (NM_014652) Human Over-expression Lysate
LS009670-20ug 20 µg

Importin 13 (IPO13) (NM_014652) Human Over-expression Lysate

Sign In for Pricing
View Details
H2afz sgRNA CRISPR Lentivector (Rat) (Target 2)
K6789503 1.0 µg DNA

H2afz sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Interleukin-17A/IL-17A Protein
PKSH032620-01 20 µg

Recombinant Human Interleukin-17A/IL-17A Protein

Sign In for Pricing
View Details