Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human-hek-293-his.html

Purity

98.0

Smiles

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (L20-L148) (Accession)

Molecular Weight

Approximately 16-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

[KO Validated] Hexokinase II Rabbit pAb
E45R17631N-100 100 µL

[KO Validated] Hexokinase II Rabbit pAb

Sign In for Pricing
View Details
Human IL-17A (Interleukin 17 A) ELISA Kit
EH3267-CM 96 Tests

Human IL-17A (Interleukin 17 A) ELISA Kit

Sign In for Pricing
View Details
CO044, CT (C15orf44, UPF0464 protein C15orf44) (MaxLight 750) discontinued
034065-ML750 100 µL

CO044, CT (C15orf44, UPF0464 protein C15orf44) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MHP 133 50mg
A20058-50 50 mg

MHP 133 50mg

Sign In for Pricing
View Details
HA1 (ARHGAP45) (NM_012292) Human Tagged ORF Clone
RG209595 10 µg

HA1 (ARHGAP45) (NM_012292) Human Tagged ORF Clone

Sign In for Pricing
View Details
HMBS (1-361, His-tag) Human Protein
AR50258PU-S 100 µg

HMBS (1-361, His-tag) Human Protein

Sign In for Pricing
View Details