Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 1 (FGF1)

Product Specifications

Product Name Alternative

FGF-1; Acidic fibroblast growth factor; aFGF; Endothelial cell growth factor; ECGF; Heparin-binding growth factor 1; HBGF-1

Abbreviation

Recombinant Chicken FGF1 protein

Gene Name

FGF1

UniProt

P19596

Expression Region

16-155aa

Organism

Gallus gallus (Chicken)

Target Sequence

FGLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQLSAEDVGEVYIKSTASGQYLAMDTNGLLYGSQLPGEECLFLERLEENHYNTYISKKHADKNWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and FGFR1 are essential for FGF1 signaling.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 pTyr705 Rabbit Polyclonal Antibody
AP02344PU-S 50 µL

STAT3 pTyr705 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFA10 Human Gene Knockout Kit (CRISPR)
KN401572 1 Kit

NDUFA10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DLL1 (Delta-like protein 1) ELISA kit
E-EL-H6218-01 24 Tests

Human DLL1 (Delta-like protein 1) ELISA kit

Sign In for Pricing
View Details
Human DLL1 (Delta-like protein 1) ELISA kit
E-EL-H6218-02 48 Tests

Human DLL1 (Delta-like protein 1) ELISA kit

Sign In for Pricing
View Details
Human DLL1 (Delta-like protein 1) ELISA kit
E-EL-H6218-03 96 Tests

Human DLL1 (Delta-like protein 1) ELISA kit

Sign In for Pricing
View Details
DBPA (YBX3) (NM_003651) Human Recombinant Protein
TP305856M 100 µg

DBPA (YBX3) (NM_003651) Human Recombinant Protein

Sign In for Pricing
View Details