Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)

Product Specifications

Abbreviation

Recombinant Human BTLA protein, partial (Active)

Gene Name

BTLA

UniProt

Q7Z6A9

Expression Region

31-157aa

Organism

Homo sapiens (Human)

Target Sequence

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYR

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human BTLA at 2 μg/mL can bind Anti-BTLA recombinant antibody (CSB-RA773799MAIHU) . The EC50 is 11.56-13.00 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.1 kDa

References & Citations

"Point mutations in the BTLA gene in multiple myeloma and other hematologic malignancies." Mao Y., Wang X., Wu H., Chen Y., Ge Y., Chen J., Zhang X. Submitted to EMBL/GenBank/DDBJ databases (APR-2004) "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Gibbs R.A. Nature 440:1194-1198 (2006) "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBFB Human Gene Knockout Kit (CRISPR)
KN202111 1 Kit

CBFB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS515529 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Mouse Scgb3a1 activation kit by CRISPRa
GA207888 1 Kit

Mouse Scgb3a1 activation kit by CRISPRa

Sign In for Pricing
View Details
PPOX (NM_000309) Human Over-expression Lysate
LY424808 100 µg

PPOX (NM_000309) Human Over-expression Lysate

Sign In for Pricing
View Details
ATM Recombinant Rabbit Monoclonal Antibody [SI70-01]
ET1606-20 100 µL

ATM Recombinant Rabbit Monoclonal Antibody [SI70-01]

Sign In for Pricing
View Details
Human FRG2 activation kit by CRISPRa
GA118563 1 Kit

Human FRG2 activation kit by CRISPRa

Sign In for Pricing
View Details