Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein (FABP5)

Product Specifications

Product Name Alternative

Epidermal-type fatty acid-binding protein

Abbreviation

Recombinant Human FABP5 protein

Gene Name

FABP5

UniProt

Q01469

Expression Region

1-135aa

Organism

Homo sapiens (Human)

Target Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.

Molecular Weight

42.2 kDa

References & Citations

"Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLO1 Antibody - N-terminal region : Biotin (ARP54803_P050-Biotin)
ARP54803_P050-Biotin 100 µL

GLO1 Antibody - N-terminal region : Biotin (ARP54803_P050-Biotin)

Sign In for Pricing
View Details
TBKBP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46284124 3x 1.0µg DNA

TBKBP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
MIF Rabbit Monoclonal Antibody
E56G3472 100 µL

MIF Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bovine Acidic Mammalian Chitinase (CHIA) ELISA Kit-Sandwich
EK12F259-01 48 Test

Bovine Acidic Mammalian Chitinase (CHIA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Acidic Mammalian Chitinase (CHIA) ELISA Kit-Sandwich
EK12F259-02 96 Tests

Bovine Acidic Mammalian Chitinase (CHIA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
PKIB CRISPR All-in-one AAV vector set (with saCas9)(Rat)
36880156 3x 1.0 µg DNA

PKIB CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details