Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Rev (rev)

Product Specifications

Product Name Alternative

ART/TRS (Anti-repression transactivator) (Regulator of expression of viral proteins)

Abbreviation

Recombinant Human immunodeficiency virus type 1 group M subtype C rev protein

Gene Name

Rev

UniProt

Q75006

Expression Region

1-107aa

Organism

Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) (HIV-1)

Target Sequence

MAGRSGDSDEELLKAVRIIKILYQSNPYPTPEGTRQARRNRRRRWRARQRQIHTLSERILSNFLGRPAEPVPLQLPPLERLNLDCSEDSGTSGTQQSQGTTEGVGNP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magea9 Mouse Gene Knockout Kit (CRISPR)
KN500325 1 Kit

Magea9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAR1B Antibody
8C16030-AAT 50 µg

SAR1B Antibody

Sign In for Pricing
View Details
Recombinant Sprouty 4 Antibody
RC-4763-01 50 μL

Recombinant Sprouty 4 Antibody

Sign In for Pricing
View Details
Recombinant Sprouty 4 Antibody
RC-4763-02 100 µL

Recombinant Sprouty 4 Antibody

Sign In for Pricing
View Details
Recombinant Sprouty 4 Antibody
RC-4763-03 1 mL

Recombinant Sprouty 4 Antibody

Sign In for Pricing
View Details
ADGRF4 Antibody
KC-33324-01 50 μL

ADGRF4 Antibody

Sign In for Pricing
View Details