Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Rev (rev)

Product Specifications

Product Name Alternative

ART/TRS (Anti-repression transactivator) (Regulator of expression of viral proteins)

Abbreviation

Recombinant Human immunodeficiency virus type 1 group M subtype C rev protein

Gene Name

Rev

UniProt

Q75006

Expression Region

1-107aa

Organism

Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) (HIV-1)

Target Sequence

MAGRSGDSDEELLKAVRIIKILYQSNPYPTPEGTRQARRNRRRRWRARQRQIHTLSERILSNFLGRPAEPVPLQLPPLERLNLDCSEDSGTSGTQQSQGTTEGVGNP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgA Immunoglobulin (IA761), CF640R conjugate, 0.1mg/mL
BNC400761-100 1x 100 µL

Human IgA Immunoglobulin (IA761), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Sulfotransferase 4A1/SULT4A1 Protein
PKSH033087-01 10 µg

Recombinant Human Sulfotransferase 4A1/SULT4A1 Protein

Sign In for Pricing
View Details
Recombinant Human Sulfotransferase 4A1/SULT4A1 Protein
PKSH033087-02 50 µg

Recombinant Human Sulfotransferase 4A1/SULT4A1 Protein

Sign In for Pricing
View Details
MAPT / TAU Rabbit Polyclonal Antibody
AP02763PU-N 100 µL

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: OTI8A7]
CF813085 100 µg

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: OTI8A7]

Sign In for Pricing
View Details
TAB3 Polyclonal Antibody
E-AB-15187-01 20 µL

TAB3 Polyclonal Antibody

Sign In for Pricing
View Details