Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Rev (rev)

Product Specifications

Product Name Alternative

ART/TRS (Anti-repression transactivator) (Regulator of expression of viral proteins)

Abbreviation

Recombinant Human immunodeficiency virus type 1 group M subtype C rev protein

Gene Name

Rev

UniProt

Q75006

Expression Region

1-107aa

Organism

Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) (HIV-1)

Target Sequence

MAGRSGDSDEELLKAVRIIKILYQSNPYPTPEGTRQARRNRRRRWRARQRQIHTLSERILSNFLGRPAEPVPLQLPPLERLNLDCSEDSGTSGTQQSQGTTEGVGNP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIN1 Polyclonal Antibody
E-AB-68400-01 60 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-02 120 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Polyclonal Antibody
E-AB-68400-03 200 µL

GRIN1 Polyclonal Antibody

Sign In for Pricing
View Details
UACA / Nucling (UACA/1222), CF740 conjugate, 0.1mg/mL
BNC741222-100 1x 100 µL

UACA / Nucling (UACA/1222), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC22A2 Rabbit Polyclonal Antibody
HA500306 100 µL

SLC22A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trp53 Mouse Gene Knockout Kit (CRISPR)
KN318278RB 1 Kit

Trp53 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details