Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida RNA polymerase sigma factor RpoS (rpoS)

Product Specifications

Abbreviation

Recombinant Pseudomonas putida rpoS protein

Gene Name

RpoS

UniProt

Q88ME8

Expression Region

1-335aa

Organism

Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)

Target Sequence

MALSKEVPEFDIDDDVLLMETGIVLETDVVSDEPAVSSVRTRAKSGSSLKQHKYIDYSRALDATQLYLNEIGFSPLLSPEEEVHFARLSQKGDPAGRKRMIESNLRLVVKIARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARELTQKLDHEPSPEEIATLLEKPVAEVKRMLGLNERVSSVDVSLGPDSDKTLLDTLTDDRPTDPCELLQDDDLSQSIDQWLGELTDKQREVVVRRFGLRGHESSTLEDVGLEIGLTRERVRQIQVEGLKRLREILEKNGLSSESLFQ

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.2 kDa

References & Citations

"Complete genome sequence and comparative analysis of the metabolically versatile Pseudomonas putida KT2440." Nelson K.E., Weinel C., Paulsen I.T., Dodson R.J., Hilbert H., Martins dos Santos V.A., Fouts D.E., Gill S.R., Pop M., Holmes M., Brinkac L., Beanan M., DeBoy R.T., Daugherty S., Kolonay J., Madupu R., Nelson W., White O. Fraser C.M. Environ. Microbiol. 4:799-808 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL8/CXCL8 Antibody
KC-403-01 50 μL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-403-02 100 µL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
IL8/CXCL8 Antibody
KC-403-03 1 mL

IL8/CXCL8 Antibody

Sign In for Pricing
View Details
Visfatin (NAMPT) Human Gene Knockout Kit (CRISPR)
KN210707LP 1 Kit

Visfatin (NAMPT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
METTL2A Human Gene Knockout Kit (CRISPR)
KN402672 1 Kit

METTL2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD4 (NM_001195014) Human Over-expression Lysate
LC434120 20 µg

CD4 (NM_001195014) Human Over-expression Lysate

Sign In for Pricing
View Details