Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6), Biotinylated

Product Specifications

Product Name Alternative

IL-6; B-cell stimulatory factor 2; BSF-2; CTL differentiation factor; CDF; Hybridoma growth factor; Interferon beta-2; IFN-beta-2

Abbreviation

Recombinant Human IL6 protein, Biotinylated

Gene Name

IL6

UniProt

P05231

Expression Region

30-212aa

Organism

Homo sapiens (Human)

Target Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Tag

N-terminal Avi-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable) . The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable) . ; IL6 is a potent inducer of the acute phase response. Rapid production of IL6 contributes to host defense during infection and tissue injury, but excessive IL6 synthesis is involved in disease pathology. In the innate immune response, is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognition of pathogens through toll-like receptors (TLRs) at the site of infection or tissue injury (Probable) . In the adaptive immune response, is required for the differentiation of B cells into immunoglobulin-secreting cells. Plays a major role in the differentiation of CD4 (+) T cell subsets. Essential factor for the development of T follicular helper (Tfh) cells that are required for the induction of germinal-center formation. Required to drive naive CD4 (+) T cells to the Th17 lineage. Also required for proliferation of myeloma cells and the survival of plasmablast cells. ; Acts as an essential factor in bone homeostasis and on vessels directly or indirectly by induction of VEGF, resulting in increased angiogenesis activity and vascular permeability. Induces, through 'trans-signaling' and synergistically with IL1B and TNF, the production of VEGF. Involved in metabolic controls, is discharged into the bloodstream after muscle contraction increasing lipolysis and improving insulin resistance. 'Trans-signaling' in central nervous system also regulates energy and glucose homeostasis. Mediates, through GLP-1, crosstalk between insulin-sensitive tissues, intestinal L cells and pancreatic islets to adapt to changes in insulin demand. Also acts as a myokine (Probable) . Plays a protective role during liver injury, being required for maintenance of tissue regeneration. Also has a pivotal role in iron metabolism by regulating HAMP/hepcidin expression upon inflammation or bacterial infection. Through activation of IL6ST-YAP-NOTCH pathway, induces inflammation-induced epithelial regeneration.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human SLC31A2 shRNA (UAS) - Lentiviral human SLC31A2 shRNA (UAS, GFP) (25)
GTR15342887 1 Vial

Lentiviral human SLC31A2 shRNA (UAS) - Lentiviral human SLC31A2 shRNA (UAS, GFP) (25)

Ask
View Details
Pig HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
ELK5662-01 48 Tests

Pig HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Ask
View Details
Pig HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
ELK5662-02 96 Tests

Pig HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Ask
View Details
Pig HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
ELK5662-03 5x 96 Tests

Pig HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Ask
View Details
SERPINA11 Human shRNA Plasmid Kit (Locus ID 256394)
TL318175 1 Kit

SERPINA11 Human shRNA Plasmid Kit (Locus ID 256394)

Ask
View Details
Human AMPK gamma 3 (PRKAG3) activation kit by CRISPRa
GA110019 1 Kit

Human AMPK gamma 3 (PRKAG3) activation kit by CRISPRa

Ask
View Details