Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Citrate Synthase/CS, Human (sf9, His)

Citrate synthase (CS) is a key enzyme in carbohydrate metabolism, especially in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA into citric acid. This enzymatic process represents the first and critical step in the TCA cycle, which is the basis of cellular energy production. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

Citrate Synthase/CS Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/citrate-synthase-cs-protein-human-sf9-his.html

Purity

90.0

Smiles

ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

Molecular Formula

1431 (Gene_ID) O75390 (A28-G466) (Accession)

Molecular Weight

Approximately 46 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLA1 Antibody (C-Term) [APR33600G]
APR33600G-01 50 µL

POLA1 Antibody (C-Term) [APR33600G]

Sign In for Pricing
View Details
POLA1 Antibody (C-Term) [APR33600G]
APR33600G-02 100 µL

POLA1 Antibody (C-Term) [APR33600G]

Sign In for Pricing
View Details
POLA1 Antibody (C-Term) [APR33600G]
APR33600G-03 200 µL

POLA1 Antibody (C-Term) [APR33600G]

Sign In for Pricing
View Details
POLA1 Antibody (C-Term) [APR33600G]
APR33600G-04 400 µL

POLA1 Antibody (C-Term) [APR33600G]

Sign In for Pricing
View Details
SB-674042 100mg
A15233-100 100 mg

SB-674042 100mg

Sign In for Pricing
View Details
Id4 Polyclonal Antibody
RA26151-01 50 µL

Id4 Polyclonal Antibody

Sign In for Pricing
View Details