Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Human

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human is a recombinant human M-CSF protein expressed in E. coli with tag-free.

Product Specifications

Product Name Alternative

M-CSF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-human.html

Purity

98.0

Smiles

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Formula

1435 (Gene_ID) P09603-3 (E33-S190) (Accession)

Molecular Weight

Approximately 19 kDa band in SDS-PAGE under reducing conditions.

References & Citations

[4]Eubank TD, et al. M-CSF induces vascular endothelial growth factor production and angiogenic activity from human monocytes. J Immunol. 2003 Sep 1;171 (5) :2637-43.|[5]Jaguin M, et al. Polarization profiles of human M-CSF-generated macrophages and comparison of M1-markers in classically activated macrophages from GM-CSF and M-CSF origin. Cell Immunol. 2013 Jan;281 (1) :51-61.|[6]Sakurai T, et al. Effect of macrophage colony-stimulating factor (M-CSF) on mouse immune responses in vivo. Immunopharmacol Immunotoxicol. 1998 Feb;20 (1) :79-102.|[1]Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF) . Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71.|[2]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[3]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse 2310030G06Rik (NM_025865) AAV Particle
MR200901A1V 250 µL

Mouse 2310030G06Rik (NM_025865) AAV Particle

Ask
View Details
Hsa-miR-7515 agomir
HY-R02403A-01 5 nmol

Hsa-miR-7515 agomir

Ask
View Details
Hsa-miR-7515 agomir
HY-R02403A-02 20 nmol

Hsa-miR-7515 agomir

Ask
View Details
Recombinant Shigella boydii serotype 18 LexA repressor (lexA)
MBS1198316-01 0.02 mg (E-Coli)

Recombinant Shigella boydii serotype 18 LexA repressor (lexA)

Ask
View Details
Recombinant Shigella boydii serotype 18 LexA repressor (lexA)
MBS1198316-02 0.1 mg (E-Coli)

Recombinant Shigella boydii serotype 18 LexA repressor (lexA)

Ask
View Details
Recombinant Shigella boydii serotype 18 LexA repressor (lexA)
MBS1198316-03 0.02 mg (Yeast)

Recombinant Shigella boydii serotype 18 LexA repressor (lexA)

Ask
View Details