M-CSF, Human

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

[4]Eubank TD, et al. M-CSF induces vascular endothelial growth factor production and angiogenic activity from human monocytes. J Immunol. 2003 Sep 1;171 (5) :2637-43.|[5]Jaguin M, et al. Polarization profiles of human M-CSF-generated macrophages and comparison of M1-markers in classically activated macrophages from GM-CSF and M-CSF origin. Cell Immunol. 2013 Jan;281 (1) :51-61.|[6]Sakurai T, et al. Effect of macrophage colony-stimulating factor (M-CSF) on mouse immune responses in vivo. Immunopharmacol Immunotoxicol. 1998 Feb;20 (1) :79-102.|[1]Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF) . Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71.|[2]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[3]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.