Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prolactin receptor (Prlr), partial (Active)

Product Specifications

Product Name Alternative

(PRL-R)

Abbreviation

Recombinant Mouse Prlr protein, partial (Active)

Gene Name

Prlr

UniProt

Q08501

Expression Region

20-229aa

Organism

Mus musculus (Mouse)

Target Sequence

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

This is a receptor for the anterior pituitary hormone prolactin.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/mL can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC50 is 4.021-8.706 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody
PA89752HU-01 50 µg

Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody
PA89752HU-02 100 µg

Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody
PA89752HU-03 500 µg

Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody
PA89752HU-04 1 mg

Rabbit Anti-Human Mucin 1 (phospho Tyr1229) Polyclonal Antibody

Sign In for Pricing
View Details
NOX5 3'UTR Luciferase Stable Cell Line
TU015848 1.0 mL

NOX5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Claudin 5 polyclonal antibody
orb1725515-01 50 µL

Claudin 5 polyclonal antibody

Sign In for Pricing
View Details