Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPF, Human (HEK293, His)

Mesothelin Protein, especially in its membrane-anchored forms, potentially mediates cellular adhesion, implicating its role in cell interactions. Furthermore, the associated Megakaryocyte-potentiating factor (MPF) actively enhances in vitro megakaryocyte colony formation, indicating its participation in fostering specialized blood cell colonies' development. MPF Protein, Human (HEK293, His) is expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MPF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mesothelin-protein-human-250a-a-hek-293-his.html

Purity

95.0

Smiles

LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPER

Molecular Formula

10232 (Gene_ID) Q13421-2 (L37-R286) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

N-Iodosuccinimide 97% For Synthesis
01467 00100 100 g

N-Iodosuccinimide 97% For Synthesis

Ask
View Details
ANGPTL7, NT (Angiopoietin-related Protein 7, Angiopoietin-like Protein 7, Angiopoietin-like Factor, Cornea-derived Transcript 6 Protein, CDT6, UNQ313/PRO35) (PE)
MBS6463097-01 0.2 mL

ANGPTL7, NT (Angiopoietin-related Protein 7, Angiopoietin-like Protein 7, Angiopoietin-like Factor, Cornea-derived Transcript 6 Protein, CDT6, UNQ313/PRO35) (PE)

Ask
View Details
ANGPTL7, NT (Angiopoietin-related Protein 7, Angiopoietin-like Protein 7, Angiopoietin-like Factor, Cornea-derived Transcript 6 Protein, CDT6, UNQ313/PRO35) (PE)
MBS6463097-02 5x 0.2 mL

ANGPTL7, NT (Angiopoietin-related Protein 7, Angiopoietin-like Protein 7, Angiopoietin-like Factor, Cornea-derived Transcript 6 Protein, CDT6, UNQ313/PRO35) (PE)

Ask
View Details
Rabbit Monoclonal GIF Antibody (016) [PerCP]
NBP2-90227PCP 0.1 mL

Rabbit Monoclonal GIF Antibody (016) [PerCP]

Ask
View Details
V-set and immunoglobulin domain-containing protein 1 (VSIG1) Mouse ELISA Kit
I1691 96 Tests

V-set and immunoglobulin domain-containing protein 1 (VSIG1) Mouse ELISA Kit

Ask
View Details
Human TGM4 knockout cell line
ABC-KH15363 1 Vial

Human TGM4 knockout cell line

Ask
View Details