Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IBSP, Human (His-SUMO)

The IBSP protein has a strong affinity for hydroxyapatite and plays a crucial role in mineralized matrix formation, indicating its overall nature in this regard. Its tight binding suggests an important role in cell-matrix interactions, particularly in promoting RGD-dependent cell attachment. IBSP Protein, Human (His-SUMO) is the recombinant human-derived IBSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

IBSP Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ibsp-protein-human-his-sumo.html

Purity

92.00

Smiles

AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE

Molecular Formula

3381 (Gene_ID) P21815 (A129-E281) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2R)-2-(Acetylamino)butanoic Acid-d5
TRC-A168236-5MG 5 mg

(2R)-2-(Acetylamino)butanoic Acid-d5

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF488A conjugate, 0.1mg/mL
BNC881950-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human DLL1/Delta-1 Protein (His Tag)
PKSH033699-01 10 µg

Recombinant Human DLL1/Delta-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DLL1/Delta-1 Protein (His Tag)
PKSH033699-02 50 µg

Recombinant Human DLL1/Delta-1 Protein (His Tag)

Sign In for Pricing
View Details
ExoBriteTM 410/450 CD81 (Mouse/Rat) Flow Antibody (100 tests)
P019-410-500 1x 500 µL

ExoBriteTM 410/450 CD81 (Mouse/Rat) Flow Antibody (100 tests)

Sign In for Pricing
View Details
S100A4 Antibody
KC-25985-01 50 μL

S100A4 Antibody

Sign In for Pricing
View Details