Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IBSP, Human (His-SUMO)

The IBSP protein has a strong affinity for hydroxyapatite and plays a crucial role in mineralized matrix formation, indicating its overall nature in this regard. Its tight binding suggests an important role in cell-matrix interactions, particularly in promoting RGD-dependent cell attachment. IBSP Protein, Human (His-SUMO) is the recombinant human-derived IBSP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

IBSP Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ibsp-protein-human-his-sumo.html

Purity

92.00

Smiles

AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE

Molecular Formula

3381 (Gene_ID) P21815 (A129-E281) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT11 Double Nickase Plasmid (h2)
sc-409997-NIC-2 20 µg

NUDT11 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ELISA Kit For Parathyroid hormone-related protein
E0819h 96 Tests

ELISA Kit For Parathyroid hormone-related protein

Sign In for Pricing
View Details
L-Ornithine-2,3,3,4,4,5,5-d7 hydrochloride
TRC-O695554-10MG 10 mg

L-Ornithine-2,3,3,4,4,5,5-d7 hydrochloride

Sign In for Pricing
View Details
Recombinant Shigella Boydii purM Protein (aa 1-345)
VAng-Lsx09288-500gEcoli 500 µg (E. coli)

Recombinant Shigella Boydii purM Protein (aa 1-345)

Sign In for Pricing
View Details
UDP-b-L-arabinofuranose
MU162046 0.1 mg

UDP-b-L-arabinofuranose

Sign In for Pricing
View Details
Sodium Thiosulfate Pentahydrate
41900132-1 500 g

Sodium Thiosulfate Pentahydrate

Sign In for Pricing
View Details