Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Mouse (His-SUMO, solution)

IL-1F10/IL-38 proteins regulate immune responses. IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution) is the recombinant mouse-derived IL-1F10/IL-38 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-mouse-his-sumo-solution.html

Purity

97.00

Smiles

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Molecular Formula

215274 (Gene_ID) Q8R459 (M1-R152) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 Recombinant Rabbit Monoclonal Antibody [JE37-72]
HA721417 100 µL

ROR2 Recombinant Rabbit Monoclonal Antibody [JE37-72]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS521364 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Cox6c Mouse Gene Knockout Kit (CRISPR)
KN503728 1 Kit

Cox6c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chsy3 Mouse Gene Knockout Kit (CRISPR)
KN503334 1 Kit

Chsy3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-MEK1/2 (S218 + S222) Recombinant Rabbit Monoclonal Antibody [ST0490]
ET1609-50 100 µL

Phospho-MEK1/2 (S218 + S222) Recombinant Rabbit Monoclonal Antibody [ST0490]

Sign In for Pricing
View Details
DLL1 Human Gene Knockout Kit (CRISPR)
KN222399BN 1 Kit

DLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details