Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amphiregulin, Mouse

Amphiregulin Protein is marked by a deficiency in conserved residue (s) essential for the propagation of feature annotation. Amphiregulin Protein, Mouse is the recombinant mouse-derived Amphiregulin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Amphiregulin Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amphiregulin-protein-mouse.html

Purity

97.00

Smiles

SVRVEQVIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSK

Molecular Formula

11839 (Gene_ID) Q4FJT2 (S94-K191) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F9]
TA804011BM 100 µL

GLI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F9]

Sign In for Pricing
View Details
Growth Hormone 1 Antibody
KC-189-01 50 μL

Growth Hormone 1 Antibody

Sign In for Pricing
View Details
Growth Hormone 1 Antibody
KC-189-02 100 µL

Growth Hormone 1 Antibody

Sign In for Pricing
View Details
Growth Hormone 1 Antibody
KC-189-03 1 mL

Growth Hormone 1 Antibody

Sign In for Pricing
View Details
Recombinant Human CDH1 Protein (Trx Tag)
PDEH100501-01 20 µg

Recombinant Human CDH1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CDH1 Protein (Trx Tag)
PDEH100501-02 100 µg

Recombinant Human CDH1 Protein (Trx Tag)

Sign In for Pricing
View Details