Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amphiregulin, Mouse

Amphiregulin Protein is marked by a deficiency in conserved residue (s) essential for the propagation of feature annotation. Amphiregulin Protein, Mouse is the recombinant mouse-derived Amphiregulin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Amphiregulin Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amphiregulin-protein-mouse.html

Purity

97.00

Smiles

SVRVEQVIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSK

Molecular Formula

11839 (Gene_ID) Q4FJT2 (S94-K191) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF640R conjugate, 0.1mg/mL
BNC402559-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATRX Antibody
8C10627-AAT 50 µg

ATRX Antibody

Sign In for Pricing
View Details
Recombinant Human CFHR5 Protein (His Tag)
PKSH032274-01 10 µg

Recombinant Human CFHR5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CFHR5 Protein (His Tag)
PKSH032274-02 50 µg

Recombinant Human CFHR5 Protein (His Tag)

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon
CD565359 5 µg

Tissue Genomic DNA, Colon

Sign In for Pricing
View Details
4-Hydrazino-7-nitrobenzofurazane
TRC-H953903-2MG 2 mg

4-Hydrazino-7-nitrobenzofurazane

Sign In for Pricing
View Details