Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amphiregulin, Mouse

Amphiregulin Protein is marked by a deficiency in conserved residue (s) essential for the propagation of feature annotation. Amphiregulin Protein, Mouse is the recombinant mouse-derived Amphiregulin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Amphiregulin Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amphiregulin-protein-mouse.html

Purity

97.00

Smiles

SVRVEQVIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSK

Molecular Formula

11839 (Gene_ID) Q4FJT2 (S94-K191) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Olfactory receptor 1B1 (OR1B1) ELISA Kit
GTR10360607 96 Well

Human Olfactory receptor 1B1 (OR1B1) ELISA Kit

Sign In for Pricing
View Details
Rat Short stature homeobox protein 2, SHOX2 ELISA Kit
MBS9319937-01 48 Well

Rat Short stature homeobox protein 2, SHOX2 ELISA Kit

Sign In for Pricing
View Details
Rat Short stature homeobox protein 2, SHOX2 ELISA Kit
MBS9319937-02 96 Well

Rat Short stature homeobox protein 2, SHOX2 ELISA Kit

Sign In for Pricing
View Details
Rat Short stature homeobox protein 2, SHOX2 ELISA Kit
MBS9319937-03 5x 96 Well

Rat Short stature homeobox protein 2, SHOX2 ELISA Kit

Sign In for Pricing
View Details
Rat Short stature homeobox protein 2, SHOX2 ELISA Kit
MBS9319937-04 10x 96 Well

Rat Short stature homeobox protein 2, SHOX2 ELISA Kit

Sign In for Pricing
View Details
HECA AAV Vector (Mouse) (CMV)
23170104 1 µg

HECA AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details