Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACLY, Human (His-SUMO)

ACLY Protein, Human (His-SUMO) is an important enzyme in the cholesterol biosynthetic pathway. ACLY produces acetyl-CoA (AcCoA) from mitochondrial citrate for cholesterol and fatty acid biosynthesis.

Product Specifications

Product Name Alternative

ACLY Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acly-protein-human-his-sumo.html

Purity

96

Smiles

KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK

Molecular Formula

47 (Gene_ID) P53396 (K4-K265) (Accession)

Molecular Weight

Approximately 45.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human NOA1 sgRNA gene knockout kit - Lentiviral human NOA1 sgRNA gene knockout kit (100)
GTR15368296 1 Vial

Lentiviral human NOA1 sgRNA gene knockout kit - Lentiviral human NOA1 sgRNA gene knockout kit (100)

Ask
View Details
Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit
MBS2803806-01 48 Tests

Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit

Ask
View Details
Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit
MBS2803806-02 96 Tests

Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit

Ask
View Details
Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit
MBS2803806-03 5x 96 Tests

Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit

Ask
View Details
Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit
MBS2803806-04 10x 96 Tests

Rat Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit

Ask
View Details
Glucose Regulated Protein 75 (Grp75, HSPA9, heat shock 70kDa protein 9 (mortalin), CSA, HSPA9B, MGC4500, Mortalin, MOT, MOT2, mot-2, mthsp75, MTHSP75, PBP74, Peptide-binding protein 74, Stress-70 protein, mitochondrial) discontinued
389589-01 20 µL

Glucose Regulated Protein 75 (Grp75, HSPA9, heat shock 70kDa protein 9 (mortalin), CSA, HSPA9B, MGC4500, Mortalin, MOT, MOT2, mot-2, mthsp75, MTHSP75, PBP74, Peptide-binding protein 74, Stress-70 protein, mitochondrial) discontinued

Ask
View Details