Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACLY, Human (His-SUMO)

ACLY Protein, Human (His-SUMO) is an important enzyme in the cholesterol biosynthetic pathway. ACLY produces acetyl-CoA (AcCoA) from mitochondrial citrate for cholesterol and fatty acid biosynthesis.

Product Specifications

Product Name Alternative

ACLY Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acly-protein-human-his-sumo.html

Purity

96

Smiles

KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK

Molecular Formula

47 (Gene_ID) P53396 (K4-K265) (Accession)

Molecular Weight

Approximately 45.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC6 Peptide
DF8814-BP 1 mg

ERCC6 Peptide

Sign In for Pricing
View Details
TRIM14 discontinued
395656 200 µL

TRIM14 discontinued

Sign In for Pricing
View Details
Tubulin Beta (TUBB) Mouse anti-Porcine Monoclonal (TU-06) Antibody
GWB-12D0D7 0.05 mg

Tubulin Beta (TUBB) Mouse anti-Porcine Monoclonal (TU-06) Antibody

Sign In for Pricing
View Details
ASTL CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12586124 3x 1.0µg DNA

ASTL CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
AY761185 Adenovirus (Mouse)
12904054 1.0 mL

AY761185 Adenovirus (Mouse)

Sign In for Pricing
View Details
Anti-HIF-1 alpha/HIF1A Antibody Picoband®
A00013-3 100 µg/Vial

Anti-HIF-1 alpha/HIF1A Antibody Picoband®

Sign In for Pricing
View Details