Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pro-Beta-NGF, Human (223a.a)

Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Pro-Beta-NGF Protein, Human (223a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-223a-a.html

Purity

98.0

Smiles

EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Formula

4803 (Gene_ID) P01138 (E19-A241) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit
MBS7238737-01 48 Well

Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit

Ask
View Details
Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit
MBS7238737-02 96 Well

Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit

Ask
View Details
Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit
MBS7238737-03 5x 96 Well

Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit

Ask
View Details
Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit
MBS7238737-04 10x 96 Well

Rabbit Clathrin heavy chain 2 (CLTCL1) ELISA Kit

Ask
View Details
PRKCD (Protein Kinase C, delta, MAY1, MGC49908, PKCD, nPKC-delta) (HRP)
250477-HRP 100 µL

PRKCD (Protein Kinase C, delta, MAY1, MGC49908, PKCD, nPKC-delta) (HRP)

Ask
View Details
Human Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit
MBS078939-01 48 Well

Human Toll Interleukin 1 Receptor Domain Containing Adaptor Protein ELISA Kit

Ask
View Details