Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pro-Beta-NGF, Human (223a.a)

Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Pro-Beta-NGF Protein, Human (223a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-223a-a.html

Purity

98.0

Smiles

EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Formula

4803 (Gene_ID) P01138 (E19-A241) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TFAM Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
46553066 1.0 µg DNA

TFAM Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Ask
View Details
IRS-1 (Insulin Receptor Substrate 1, IRS-1, IRS1) discontinued
223707-01 50 µL

IRS-1 (Insulin Receptor Substrate 1, IRS-1, IRS1) discontinued

Ask
View Details
IRS-1 (Insulin Receptor Substrate 1, IRS-1, IRS1) discontinued
223707-02 100 µL

IRS-1 (Insulin Receptor Substrate 1, IRS-1, IRS1) discontinued

Ask
View Details
TPX2, ID (TPX2, C20orf1, C20orf2, DIL2, HCA519, Targeting protein for Xklp2, Differentially expressed in cancerous and non-cancerous lung cells 2, Hepatocellular carcinoma-associated antigen 519, Protein fls353, Restricted expression proliferation-associated protein 100)
043175 200 µL

TPX2, ID (TPX2, C20orf1, C20orf2, DIL2, HCA519, Targeting protein for Xklp2, Differentially expressed in cancerous and non-cancerous lung cells 2, Hepatocellular carcinoma-associated antigen 519, Protein fls353, Restricted expression proliferation-associated protein 100)

Ask
View Details
Zc3h7a (NM_145931) Mouse Tagged Lenti ORF Clone
MR211014L3 10 µg

Zc3h7a (NM_145931) Mouse Tagged Lenti ORF Clone

Ask
View Details
Ptges3l1 (NM_001014272) Rat Tagged Lenti ORF Clone
RR204001L3 10 µg

Ptges3l1 (NM_001014272) Rat Tagged Lenti ORF Clone

Ask
View Details