Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pro-Beta-NGF, Human (223a.a)

Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Pro-Beta-NGF Protein, Human (223a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-223a-a.html

Purity

98.0

Smiles

EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Formula

4803 (Gene_ID) P01138 (E19-A241) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human GPN1 Protein, His, E.coli-25ug
QP12040-25ug 25ug

Recombinant Human GPN1 Protein, His, E.coli-25ug

Ask
View Details
CTNNBL1 (NM_001281495) Human Tagged ORF Clone
RC238780 10 µg

CTNNBL1 (NM_001281495) Human Tagged ORF Clone

Ask
View Details
SNRPC, CT (U1 Small Nuclear Ribonucleoprotein C, U1 snRNP Protein C, U1-C, U1C) (MaxLight 650) discontinued
S1014-96K5-ML650 100 µL

SNRPC, CT (U1 Small Nuclear Ribonucleoprotein C, U1 snRNP Protein C, U1-C, U1C) (MaxLight 650) discontinued

Ask
View Details