Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pro-Beta-NGF, Human (223a.a)

Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Pro-Beta-NGF Protein, Human (223a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-223a-a.html

Purity

98.0

Smiles

EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Molecular Formula

4803 (Gene_ID) P01138 (E19-A241) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PLEKHG5 (Pleckstrin Homology Domain Containing Family G Member 5, PH Domain-containing Family G Member 5, Guanine Nucleotide Exchange Factor 720, GEF720, KIAA0720) (PE)
131458-PE 100 µL

PLEKHG5 (Pleckstrin Homology Domain Containing Family G Member 5, PH Domain-containing Family G Member 5, Guanine Nucleotide Exchange Factor 720, GEF720, KIAA0720) (PE)

Ask
View Details
AKR1A1 (NM_006066) Human Tagged Lenti ORF Clone
RC200302L1 10 µg

AKR1A1 (NM_006066) Human Tagged Lenti ORF Clone

Ask
View Details
Lentiviral mouse Cryz shRNA (UAS) - Lentiviral mouse Cryz shRNA (UAS, GFP) plasmid
GTR15158818 1 Vial

Lentiviral mouse Cryz shRNA (UAS) - Lentiviral mouse Cryz shRNA (UAS, GFP) plasmid

Ask
View Details
Human total Procollagen Type I Intact N-terminal Propeptide (total-P1NP) ELISA Kit
QY-E00065 96 Tests

Human total Procollagen Type I Intact N-terminal Propeptide (total-P1NP) ELISA Kit

Ask
View Details