Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RISC, Mouse (HEK293, His)

RISC proteins have emerged as potential regulators of blood vessel wall and renal homeostasis, suggesting a possible role for RISC proteins in regulating key processes in these physiological environments. RISC Protein, Mouse (HEK293, His) is the recombinant mouse-derived RISC protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RISC Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/risc-protein-mouse-hek293-his.html

Purity

98.0

Smiles

IDWREPEGKEVWDYVTVRKDAHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYNILTKSSPEKAMESSLEFLRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFLSMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFNQLKWKALYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVTKQE

Molecular Formula

74617 (Gene_ID) Q920A5 (I29-E452) (Accession)

Molecular Weight

Approximately 50-65 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3- (tert-butyl) phenyl) (phenyl) methanone
OR1094143-01 250 mg

(3- (tert-butyl) phenyl) (phenyl) methanone

Sign In for Pricing
View Details
(3- (tert-butyl) phenyl) (phenyl) methanone
OR1094143-02 500 mg

(3- (tert-butyl) phenyl) (phenyl) methanone

Sign In for Pricing
View Details
(3- (tert-butyl) phenyl) (phenyl) methanone
OR1094143-03 1 g

(3- (tert-butyl) phenyl) (phenyl) methanone

Sign In for Pricing
View Details
(3- (tert-butyl) phenyl) (phenyl) methanone
OR1094143-04 5 g

(3- (tert-butyl) phenyl) (phenyl) methanone

Sign In for Pricing
View Details
(3- (tert-butyl) phenyl) (phenyl) methanone
OR1094143-05 10 g

(3- (tert-butyl) phenyl) (phenyl) methanone

Sign In for Pricing
View Details
LYRM2 (NM_020466) Human Recombinant Protein
TP303091M 100 µg

LYRM2 (NM_020466) Human Recombinant Protein

Sign In for Pricing
View Details