Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Creatine kinase M-type (CKM)

Product Specifications

Product Name Alternative

(Creatine kinase M chain) (Creatine phosphokinase M-type) (CPK-M) (M-CK)

Abbreviation

Recombinant Human CKM protein

Gene Name

CKM

UniProt

P06732

Expression Region

1-381aa

Organism

Homo sapiens (Human)

Target Sequence

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) . Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

74.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 4 binding protein (EIF6) Human Gene Knockout Kit (CRISPR)
KN200568BN 1 Kit

Integrin beta 4 binding protein (EIF6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SF3A2 Polyclonal Antibody
E-AB-90250-01 60 µL

SF3A2 Polyclonal Antibody

Sign In for Pricing
View Details
SF3A2 Polyclonal Antibody
E-AB-90250-02 120 µL

SF3A2 Polyclonal Antibody

Sign In for Pricing
View Details
SF3A2 Polyclonal Antibody
E-AB-90250-03 200 µL

SF3A2 Polyclonal Antibody

Sign In for Pricing
View Details
SRPR beta (SRPRB) (C-term) Rabbit Polyclonal Antibody
AP54047PU-N 400 µL

SRPR beta (SRPRB) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
17beta-Dihydro Equilenin 3-Sulfate Sodium Salt (Stabilized with TRIS, 50% w/w)
TRC-D448965-5MG 5 mg

17beta-Dihydro Equilenin 3-Sulfate Sodium Salt (Stabilized with TRIS, 50% w/w)

Sign In for Pricing
View Details