Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS3/Trypsin-3, Human (HEK293, His)

PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (HEK293, His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRSS3/Trypsin-3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prss3-trypsin-3-protein-human-hek293-his.html

Purity

95.0

Smiles

VPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS

Molecular Formula

5646 (Gene_ID) P35030-3 (V16-S247) (Accession)

Molecular Weight

Approximately 33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STOML3 Antibody
C49504-01 40 µL

STOML3 Antibody

Sign In for Pricing
View Details
STOML3 Antibody
C49504-02 100 µL

STOML3 Antibody

Sign In for Pricing
View Details
STOML3 Antibody
C49504-03 200 µL

STOML3 Antibody

Sign In for Pricing
View Details
notchl Antibody, FITC conjugated
A48703-100UG 100 µg

notchl Antibody, FITC conjugated

Sign In for Pricing
View Details
G0 Protein alpha (GNAO1) Human Over-expression Lysate
orb1376872 20 µg

G0 Protein alpha (GNAO1) Human Over-expression Lysate

Sign In for Pricing
View Details
JAZF1 (NM_175061) Human Over-expression Lysate
LS221895 100 µg

JAZF1 (NM_175061) Human Over-expression Lysate

Sign In for Pricing
View Details