Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter fetus S-layer protein (sapA), partial

Product Specifications

Product Name Alternative

Surface array protein

Abbreviation

Recombinant Campylobacter fetus sapA protein, partial

Gene Name

SapA

UniProt

P35827

Expression Region

1-268aa

Organism

Campylobacter fetus

Target Sequence

MLNKTDVSMLYITIMGMASEGDGNKYWLDYANNNSLGVSSLANIMLDSPGAAKFFGDSLLAGNEKDFVTKIYSIALGNTSDVDGINYWTKAITGGGEFTDSKGNVISVASLSKGDLIGAMINSMVNGGSAESKAIFEAKAAASDYFADATLVRDISGLDEGTTSKLISEINSASDLDKVKSEIDALKSELPNPGSTYDLTEGNDNLKGTDLDDTFNGTTYVGNGTNKSTLSAFDKIDGGAGRDTLNAIFTANNNAAAATKLDQAEIDK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

The S-layer is a paracrystalline mono-layered assembly of proteins which coats the surface of bacteria. This protein is critical for virulence.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.0 kDa

References & Citations

"Surface array protein of Campylobacter fetus. Cloning and gene structure." Blaser M.J., Gotschlich E.C. J. Biol. Chem. 265:14529-14535 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIBF Polyclonal Antibody, Cy3 Conjugated
bs-0420R-Cy3 100 µL

PIBF Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)
MBS2049433-01 0.1 mL

APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)
MBS2049433-02 0.2 mL

APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)
MBS2049433-03 0.5 mL

APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)
MBS2049433-04 1 mL

APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)
MBS2049433-05 5 mL

APC-Linked Polyclonal Antibody to Ceruloplasmin (CP)

Sign In for Pricing
View Details