Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36 alpha/IL-1F6, Human (His)

IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36 alpha/IL-1F6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36-alpha-il-1f6-protein-human-his.html

Purity

95.0

Smiles

MKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Molecular Formula

27179 (Gene_ID) Q9UHA7 (K6-F158) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF647 conjugate, 0.1mg/mL
BNC472593-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(p-Nitrobenzylidene)malonic Acid Diethyl Ester
TRC-N493690-250MG 250 mg

(p-Nitrobenzylidene)malonic Acid Diethyl Ester

Sign In for Pricing
View Details
Tangeretin
TRC-T006555-50MG 50 mg

Tangeretin

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS643327 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
MRGPRX4 (NM_054032) Human Over-expression Lysate
LY403295 100 µg

MRGPRX4 (NM_054032) Human Over-expression Lysate

Sign In for Pricing
View Details
SPIN2B (NM_001006681) Human Over-expression Lysate
LC423547 20 µg

SPIN2B (NM_001006681) Human Over-expression Lysate

Sign In for Pricing
View Details