Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1, Mouse (His)

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CHRNA1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chrna1-protein-mouse-his.html

Purity

97.00

Smiles

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Molecular Formula

11435 (Gene_ID) P04756 (S21-L230) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)
MBS1398866-01 0.02 mg (E-Coli)

Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)
MBS1398866-02 0.02 mg (Yeast)

Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)
MBS1398866-03 0.1 mg (E-Coli)

Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)
MBS1398866-04 0.1 mg (Yeast)

Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)
MBS1398866-05 0.02 mg (Baculovirus)

Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)

Ask
View Details
Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)
MBS1398866-06 0.02 mg (Mammalian-Cell)

Recombinant Lactococcus lactis subsp. lactis DegV domain-containing protein yteA (yteA)

Ask
View Details