CHRNA1, Mouse (His)
The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CHRNA1 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/chrna1-protein-mouse-his.html
Purity
97.00
Smiles
SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
Molecular Formula
11435 (Gene_ID) P04756 (S21-L230) (Accession)
Molecular Weight
Approximately 25 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400270-100 1x 100 µL
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880158-500 1x 500 µL
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940050-100 1x 100 µL
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details